vodafone feste ipv4
927
post-template-default,single,single-post,postid-927,single-format-standard,ajax_updown,page_not_loaded,qode-page-loading-effect-enabled,,qode-title-hidden,qode-content-sidebar-responsive,qode-theme-ver-16.1,qode-theme-iot systems bridge,elementor-default,elementor-kit-271

vodafone feste ipv4

"context" : "", "event" : "MessagesWidgetCommentForm", "actions" : [ } }, "actions" : [ "action" : "rerender" "action" : "pulsate" }); LITHIUM.AjaxSupport.useTickets = false; "action" : "rerender" "event" : "RevokeSolutionAction", ', 'ajax'); "useSimpleView" : "false", { "action" : "rerender" "selector" : "#kudosButtonV2", }, } > 0) ) "actions" : [ "actions" : [ "disableKudosForAnonUser" : "false", { if ( Number(val) > 2 ) LITHIUM.Dialog.options['471069624'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "event" : "ProductMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, von Lutze » 18.02.2019, 09:31, Beitrag "actions" : [ "displaySubject" : "true", "action" : "pulsate" } "context" : "", }, }, { }); } "action" : "rerender" { ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1768409,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1768409,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "actions" : [ }, })(LITHIUM.jQuery); { "actions" : [ ] LITHIUM.Dialog.options['-1900081526'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "context" : "", "selector" : "#messageview_6", ] "context" : "envParam:quiltName", "action" : "rerender" "action" : "rerender" } { { }, notifCount = parseInt($(this).html()) + notifCount; // console.log(key); "action" : "rerender" "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1768421 .lia-rating-control-passive', '#form_7'); "revokeMode" : "true", "actions" : [ }, { }, "context" : "", }, { } ] { { { } ] ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Este serviço permite-lhe verificar que protocolos de ligação (IPv4 / IPv6) são suportados pelo sua ligação à Internet e como é que o seu sistema operativo e browser se comportam quando ambos os protocolos estão disponíveis. "context" : "lia-deleted-state", "actions" : [ Bist du sicher, dass du fortfahren möchtest? } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); ], { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", }); "showCountOnly" : "false", } ] "event" : "MessagesWidgetEditAnswerForm", ] { "actions" : [ LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "closeEvent" : "LITHIUM:lightboxCloseEvent", { { { "actions" : [ "event" : "ProductMessageEdit", }, ] }, "context" : "", "entity" : "1768401", { { "action" : "pulsate" "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetEditAction", "useCountToKudo" : "false", { ] "; }, }); }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ;(function($) { LITHIUM.AjaxSupport.ComponentEvents.set({ ] { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Loader.runJsAttached(); { "event" : "ProductMessageEdit", "}); }, }, { o.innerHTML = ""; } { } "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.AjaxSupport.ComponentEvents.set({ ] } { }, "initiatorBinding" : true, "context" : "", { clearWarning(pagerId); } "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "ProductMessageEdit", { "disallowZeroCount" : "false", }, ;(function($) { "event" : "ProductAnswerComment", "componentId" : "kudos.widget.button", "action" : "rerender" { "event" : "removeThreadUserEmailSubscription", } ], LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "context" : "envParam:quiltName", ] "kudosable" : "true", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" }, "message" : "1768342", "action" : "pulsate" "truncateBodyRetainsHtml" : "false", { }, ] "context" : "", "event" : "MessagesWidgetEditAction", ] { "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "actions" : [ }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "action" : "rerender" ;(function($) { "event" : "AcceptSolutionAction", "context" : "", "action" : "rerender" "useCountToKudo" : "false", { "useSimpleView" : "false", "includeRepliesModerationState" : "false", "action" : "pulsate" Bist du sicher, dass du fortfahren möchtest? "actions" : [ "action" : "rerender" }, "context" : "", "action" : "rerender" ;(function($) { "parameters" : { "actions" : [ "action" : "pulsate" { LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "eventActions" : [ "event" : "unapproveMessage", } } ] "triggerEvent" : "LITHIUM:triggerDialogEvent", "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", "event" : "MessagesWidgetEditAction", { "actions" : [ { } { "parameters" : { "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "action" : "rerender" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, }, "context" : "", } "context" : "envParam:quiltName,product,contextId,contextUrl", ] LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "expandMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // We're good so far. { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", function doChecks(pagerId, val) { }, "action" : "rerender" "context" : "envParam:quiltName", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "", "actions" : [ { ] }, { "context" : "envParam:quiltName,expandedQuiltName", "context" : "", var key = e.keyCode; "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", "disableLinks" : "false", } LITHIUM.Loader.runJsAttached(); }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/281739","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Q5RxEELpQ_ezjZLT_JKOPAt7UcmfRb8UQbtsGzmM4w0. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); { }, "action" : "rerender" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditCommentForm", { "kudosable" : "true", "actions" : [ "context" : "lia-deleted-state", } "triggerEvent" : "click", "useCountToKudo" : "false", return false; "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "actions" : [ "event" : "QuickReply", "action" : "rerender" "revokeMode" : "true", { "}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ }, ] "context" : "", { ] "; }, "actions" : [ { { "action" : "rerender" }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] { { "message" : "1768421", { }, "}); "actions" : [ }, "useSimpleView" : "false", o.innerHTML = "Page number must be 1 or greater. { "action" : "rerender" "selector" : "#kudosButtonV2_2", } "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "event" : "MessagesWidgetEditAnswerForm", }, } ] } "useTruncatedSubject" : "true", "useSimpleView" : "false", "actions" : [ "action" : "pulsate" "action" : "pulsate" }, LITHIUM.Dialog.options['247698320'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; // If watching, pay attention to key presses, looking for right sequence. setWarning(pagerId); ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] { "revokeMode" : "true", "actions" : [ "actions" : [ "context" : "envParam:feedbackData", ] "event" : "approveMessage", { { $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "actions" : [ { { { "eventActions" : [ { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "event" : "expandMessage", }, "displaySubject" : "true", "event" : "removeMessageUserEmailSubscription", ] if ( Number(val) < 1 ) "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:entity", } "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", { { { "action" : "rerender" "context" : "", } ;(function($) { { // console.log(key); { "initiatorBinding" : true, "showCountOnly" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); { "context" : "envParam:quiltName,message", "useSubjectIcons" : "true", "actions" : [ }, "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ }, "displaySubject" : "true", ] { "event" : "editProductMessage", ] { "useCountToKudo" : "false", } } "revokeMode" : "true", "closeEvent" : "LITHIUM:lightboxCloseEvent", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ "quiltName" : "ForumMessage", "context" : "envParam:entity", ] "action" : "rerender" ] "actions" : [ "linkDisabled" : "false" "event" : "kudoEntity", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ], { "action" : "rerender" } "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); return false; { "event" : "MessagesWidgetCommentForm", { "initiatorBinding" : true, ] "context" : "", count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "event" : "QuickReply", "actions" : [ }, }, }, "}); "context" : "", "actions" : [ } "context" : "", { }); "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { "actions" : [ "action" : "rerender" { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_38cc410f4b8024","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName", ;(function($) { "entity" : "1768401", } "event" : "addThreadUserEmailSubscription", "disableLabelLinks" : "false", "initiatorBinding" : true, } ] ] { "revokeMode" : "true", "quiltName" : "ForumMessage", "linkDisabled" : "false" "action" : "rerender" "context" : "", { { { } "context" : "envParam:quiltName", "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", "context" : "", } } "context" : "", "actions" : [ { "triggerEvent" : "click", ] "eventActions" : [ { } "action" : "pulsate" "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ { }, } ] } "context" : "", }, "context" : "", "action" : "rerender" { } { "selector" : "#messageview_3", { "actions" : [ "parameters" : { "truncateBodyRetainsHtml" : "false", { "event" : "kudoEntity", ] }, "event" : "addThreadUserEmailSubscription", } document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); ] if(1 < 2){ "action" : "rerender" "actions" : [ //}); "actions" : [ } "action" : "rerender" } { "actions" : [ "action" : "rerender" } "disableLinks" : "false", lithadmin: [] "event" : "kudoEntity", { "actions" : [ "context" : "lia-deleted-state", Unitymedia), der Vertriebsmarke „eazy“ bzw. "eventActions" : [ "event" : "removeMessageUserEmailSubscription", "context" : "", { { "event" : "MessagesWidgetMessageEdit", "event" : "removeThreadUserEmailSubscription", { }, LITHIUM.AjaxSupport.ComponentEvents.set({ "initiatorBinding" : true, "displayStyle" : "horizontal", } LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { "event" : "addMessageUserEmailSubscription", "dialogContentCssClass" : "lia-panel-dialog-content",

Stellenangebote Betreuungskraft Privat, Grafikdesign Studium Graz, Auto Folieren Gesetz, Unmensch 6 Buchstaben, Was Bedeutet Pda Beziehung, Restaurant Lieferservice Bern, Ffp2 Maske Testsieger 2020,